PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_628_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family CPP
Protein Properties Length: 540aa    MW: 59255.2 Da    PI: 8.7243
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_628_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR38.81.9e-12116155242
           TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                   ++k+C+Ck+s Clk+YCeCfaag +C+  C+C+ C+N+ e+
  Neem_628_f_3 116 DRKHCRCKQSGCLKLYCECFAAGGYCDG-CNCNCCRNNVEN 155
                   689*************************.********9875 PP

2TCR50.25.2e-16200241142
           TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                   k+++gC+Ckk+ Clk+YCeCf+a++ Cs++CkC dCkN+ee+
  Neem_628_f_3 200 KHNWGCRCKKTGCLKNYCECFHAKVSCSKNCKCMDCKNSEEH 241
                   5899***********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.2E-12115155IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163433.586116240IPR005172CRC domain
PfamPF036382.4E-9118152IPR005172CRC domain
SMARTSM011141.5E-15200241IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.6E-12203238IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MSPPNAVLNF FPPKPSKLVE KANDSVTDKS SFPPKPTKSV EKSGVSPEKL VMQLVFTKFG  60
LSPVIKMPST KLSLSLSPAK PYTTLHSSFP FPLSKQKPPT SHQQTDMKRN NGAPTDRKHC  120
RCKQSGCLKL YCECFAAGGY CDGCNCNCCR NNVENEGLRK AAMESILQRN PNAFRPKIPT  180
SPSNAQDNVD DAKDNSMVGK HNWGCRCKKT GCLKNYCECF HAKVSCSKNC KCMDCKNSEE  240
HQEKVALPGR DYNSTKIFNN YEGYKKSVAV AGGGNTNTNI SKNFEGSKER EAITNADHGE  300
PNICKNFEGH KEAMACPRRA SRKRKLQEFL DLNEKDAPIQ KLKNHQKVNP LRVYSSLSAL  360
SVGPVGNVGN ASILNPKEFQ CSARSSFAEQ DVEQLCSLLV LASEAAKKVL DKNGNQAVRK  420
IQTANTSEVQ DSKIFEEEPN VQKETLDDHL SETEADATNT GSHISGGNEG KEGRLSSPGA  480
IALRSNGKDE LITGATKQDQ ILIHGCNGDV YLEQERLVLA SFRDCLKKII VLGNKKGEIL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.12e-54Tesmin/TSO1-like CXC domain-containing protein